PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 968aa    MW: 107022 Da    PI: 4.748
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18199.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.9e-131452948
                     HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     de+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       KHN18199.1 14 DEILRKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 52
                     89*********************9.************986 PP

2Myb_DNA-binding65.88.1e-2158104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++d+v+++G++ W+tIa++++ gR +kqc++rw+++l
       KHN18199.1  58 KGPWSKEEDEIIIDLVNRYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 104
                      79******************************.*************97 PP

3Myb_DNA-binding54.72.3e-17110152145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+  a+ ++ gRt++++k++w+
       KHN18199.1 110 KEAWTQEEELALIRAHQIYGNR-WAELAKLLP-GRTDNSIKNHWN 152
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.598152IPR017930Myb domain
CDDcd001671.34E-91452No hitNo description
Gene3DG3DSA:1.10.10.602.2E-201469IPR009057Homeodomain-like
PfamPF002494.7E-101452IPR001005SANT/Myb domain
SMARTSM007178.8E-51454IPR001005SANT/Myb domain
SuperFamilySSF466895.6E-111462IPR009057Homeodomain-like
PROSITE profilePS5129432.42653108IPR017930Myb domain
SuperFamilySSF466891.98E-3155151IPR009057Homeodomain-like
SMARTSM007174.3E-1957106IPR001005SANT/Myb domain
PfamPF002497.3E-1958104IPR001005SANT/Myb domain
CDDcd001678.68E-1760104No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2770111IPR009057Homeodomain-like
PROSITE profilePS5129421.387109159IPR017930Myb domain
SMARTSM007172.8E-17109157IPR001005SANT/Myb domain
PfamPF002491.5E-15110153IPR001005SANT/Myb domain
CDDcd001671.80E-13112152No hitNo description
Gene3DG3DSA:1.10.10.608.8E-23112159IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 968 aa     Download sequence    Send to blast
MEGDQTIPAA SDVDEILRKA VQRFKGKNWK KIAECFKDRT DVQCLHRWQK VLNPELVKGP  60
WSKEEDEIII DLVNRYGPKK WSTIAQHLPG RIGKQCRERW HNHLNPTINK EAWTQEEELA  120
LIRAHQIYGN RWAELAKLLP GRTDNSIKNH WNSSVKKKLD SYLASGLLTQ LQNVPLVGNP  180
NQPIASISSR LQQSGDDNGP RGTEGEEVSQ CSQESANAGH FSSARDMSSV VLQTGEEYRP  240
SEEPSQASCS EPYYVSLDEV TASLQDMAGQ EICTSQFIEQ KYSHKPRNSS NGDCQLDLLD  300
LTNISSLDFG QESSQMQNDC VAPSENHNIV NVPFQTSMGL GVATTMGPTS VKPEHMLMSD  360
DECCRILFSE AISDECFSSG DYSKGVNMVN LSGCTSFLCQ SSLPSVPSVV SSAGDRLTYT  420
YTAEANQLVG SEDQQFVSRT QDNIIYANDL SSSPCIHRID STEMQEPSDV VKGDSKLVPV  480
NSFGCGSDAK QTSYPTDEKP NMLTEQEDKG ALCYEPPRFP SLDIPFLSCD LIQSGGDMQQ  540
EFSPLGIRQF MMSSMNMDLT PFRLWDSPSR DDSPDALLKS AAKTFTGTPS ILKKRNRDLL  600
SPLSDKRIDK RLEIEMTSTL IKNFSRLDVM FDDNETQGAD LLPASSMQKR DSGTSVEGDK  660
QNCGQAVKVE QVEDKNKSAI LNDKKSEDDS GDNNSLDKIK QQPLDVDSEI KNDASAAAEI  720
VQQPSGILVE HDRNDLLLYS PDQVNLKSEK KISLSARTKK NPCSRINSPS AWVKEHERLS  780
VAVTCVQSIS SSGPGENSGD HIGNDGGLET CNIFGGTPFR KSIESPSAWK SPWFMNTFLS  840
SPRIDTEITI EDFGYFMSPG DRSYDAIGLM KQISEQTAAQ YASAQEILGN ETPKALPKDA  900
SRNDRDEDQE HIDAHNQHGN HCQLASSALV ERRVLDFSEC GTPVRGDSSK SSAKNFSSPS  960
SYLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-66815914159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-66815914159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527826.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0B2QDW20.0A0A0B2QDW2_GLYSO; Myb-related protein 3R-1
STRINGGLYMA06G08660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]